Protein coding transcript 271

• Transcript: Ll_transcript_367145
• CDS coordinates: 3-407 (+)
• Peptide sequence: ATDSVTRRAYNLQSPTGPFAGELHRTPHRTHARDAHLPIMATTVDKIKQIEDEKAKTQKNKATSFHLGQLKAKLSKLKKELLTPTTSGGGGGAGFDVARTGVASVGFIGFPSVGKSTLMSRLSGQHSEAAAYEFT
• ORF Type: internal

Annotations of Ll_transcript_367145

• Blastp: Ribosome-interacting GTPase 1 from Saccharomyces with 77.55% of identity
• Blastx: Uncharacterized GTP-binding protein C9.07c from Schizosaccharomyces with 77.08% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YAL036C)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003602486.1)
• Pfam: Chlamydia polymorphic membrane protein (Chlamydia_PMP) repeat (PF02415.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;