Protein coding transcript 27154

• Transcript: Ll_transcript_433990
• CDS coordinates: 2160-2501 (+)
• Peptide sequence: MQLVEENLQKEPRIVELRNQCRIIRTTELAAAQEKLNELEKQKEEMLKLNSPASLLQRIQEAMNVTEEESENLHQQLLDREIDLAGFLQKYKKLRTAYHRKSLIHLAAKTSNI*
• ORF Type: complete

Annotations of Ll_transcript_433990

• Blastp: Vacuolar protein-sorting-associated protein 37 homolog 1 from Arabidopsis with 71.68% of identity
• Blastx: Vacuolar protein-sorting-associated protein 37 homolog 1 from Arabidopsis with 70.49% of identity
• Eggnog: vacuolar protein sorting 37 homolog(ENOG4111UJN)
• Kegg: Link to kegg annotations (AT3G53120)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429101.1)
• Pfam: Modifier of rudimentary (Mod(r)) protein (PF07200.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;