Protein coding transcript 2717

• Transcript: Ll_transcript_361387
• CDS coordinates: 3-515 (+)
• Peptide sequence: LCDADIALLVFSATSKLYEFASSSVQHVIERRDQHSAIHKPNPPSVELQVQSDSNNMLHQKVEYKTRELRQLNGQELHGLTLQELQRLEELLNIGLINVSKLKDDKIMQEISTLRRKEFELMEENQKSKQVLSLMRGQRQSFEFNNIRSSYLPEDDGRDTSLKLGLPLLK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_361387

• Blastp: MADS-box protein AGL24 from Arabidopsis with 42.22% of identity
• Blastx: MADS-box protein JOINTLESS from Lycopersicon with 48.48% of identity
• Eggnog: Transcription factor(COG5068)
• Kegg: Link to kegg annotations (AT4G24540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006584957.1)
• Pfam: SRF-type transcription factor (DNA-binding and dimerisation domain) (PF00319.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;