Transcript | Ll_transcript_361376 |
---|---|
CDS coordinates | 203-991 (+) |
Peptide sequence | MSSYYFNPIPTSVHLIPAGVSRKLKIPNLIHRKKRCGTSSRSSNITAFYGLKTPPYELDALEPYMSKRTLEVHWGENHKNFIDGLNKQLEKDDILYGYTLDELVKVTYNNGNPLPEFKNAAEVWNHDFFWETMQPGGGDTPKLRLLQQIEKDFGSFADFREKFIEAALGLFGSGWVWLVLKREERRLEIVKTSNAICPIVWDDIPIINLDLWEHAYYLDYKNDRAKYVNVFMDHLVSWNVALGRLAWAQAFVNLGEPKIPAK* |
ORF Type | complete |
Blastp | Superoxide dismutase [Fe] 3, chloroplastic from Arabidopsis with 67.58% of identity |
---|---|
Blastx | Superoxide dismutase [Fe] 3, chloroplastic from Arabidopsis with 67.58% of identity |
Eggnog | Destroys radicals which are normally produced within the cells and which are toxic to biological systems (By similarity)(COG0605) |
Kegg | Link to kegg annotations (AT5G23310) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462492.1) |
Pfam | Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer