Transcript | Ll_transcript_434256 |
---|---|
CDS coordinates | 500-1417 (+) |
Peptide sequence | MTDISMAKRYCYNDLLPFGAMVIMETINVALNTLFKAATLRGMSYHVFIVYAYSVAAILLIPAPFISQRSRVLPPLSYPILCKIGLLGLIGCSSQIVGYTGISFSSPTLSSAISNLVPAFTFLLAIMFRMEKVVVKSASTQAKILGTIVSISGAFAVTLYKGPPIIIISHTPSNSLQKPLNTFNSVDTNWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELTVIFFYNSCVSIMAAIVAIFTEKNSSAWKIGLDTSLASILCSGIFGSFLNNAVHTWVLRIKGPVYVAMFKPLSIAIAVVLGVLF |
ORF Type | 3prime_partial |
Blastp | WAT1-related protein At3g28050 from Arabidopsis with 60.6% of identity |
---|---|
Blastx | WAT1-related protein At3g28050 from Arabidopsis with 60.6% of identity |
Eggnog | Nodulin MtN21 family protein(ENOG4111ADX) |
Kegg | Link to kegg annotations (AT3G28050) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019452139.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer