Protein coding transcript 27253

• Transcript: Ll_transcript_434258
• CDS coordinates: 2509-3039 (+)
• Peptide sequence: MEKVVVKSASTQAKILGTIVSISGAFAVTLYKGPPIIIISHTPSNSLQKPLNTFNSVDTNWAIGGLLLTAEYILVPLWYIVQVQIMKVYPNELTVIFFYNSCVSIMAAIVAIFTEKNSSAWKIGLDTSLASILCSGIFGSFLNNAVHTWVLRIKGPVYVAMFKPLSIAIAVVLGVLF
• ORF Type: 3prime_partial

Annotations of Ll_transcript_434258

• Blastp: WAT1-related protein At3g28050 from Arabidopsis with 56.18% of identity
• Blastx: WAT1-related protein At3g28050 from Arabidopsis with 55.8% of identity
• Eggnog: Nodulin MtN21 family protein(ENOG4111ADX)
• Kegg: Link to kegg annotations (AT3G28050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452139.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;