| Transcript | Ll_transcript_434264 |
|---|---|
| CDS coordinates | 500-820 (+) |
| Peptide sequence | MTDISMAKRYCYNDLLPFGAMVIMETINVALNTLFKAATLRGMSYHVFIVYAYSVAAILLIPAPFISQRSRVLPPLSYPILCKIGLLGLIGYMIHIYIYIYTPELL* |
| ORF Type | complete |
| Blastp | WAT1-related protein At3g28050 from Arabidopsis with 59.57% of identity |
|---|---|
| Blastx | WAT1-related protein At5g40230 from Arabidopsis with 46% of identity |
| Eggnog | Nodulin MtN21 family protein(ENOG4111ADX) |
| Kegg | Link to kegg annotations (AT3G28050) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_017437680.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer