Transcript | Ll_transcript_433855 |
---|---|
CDS coordinates | 322-1314 (+) |
Peptide sequence | MQCKKKMSYHHSFIFIATLFLLLTCNAQLHVDHYRNTCPHVASIVRSAVQKKFQQTFVTAPSTLRLFFHDCFVRGCDASVILVSRNGTTEKDNPINLSLAGDGFDTVIRAKAAVDSVPGCRNKVSCADILALAARDVIALTGGPSYAVELGRLDGRISTKASVNNHLPHPQFTLTKLIQMFASHGLNLVDLVALSGAHTIGFSHCSQFSKRIYNFRSRNKIDPTLNLAYAKQIQQECPKNVDPRMVIDMDPVTNNVFDNNYYKNIQQGKGLLSSDQALFTDRRSRSIVNLFASNSTAFEKSFVIAMTKLGRVGIKTGKQGEIRRNCAMVN* |
ORF Type | complete |
Blastp | Peroxidase 16 from Arabidopsis with 61.66% of identity |
---|---|
Blastx | Peroxidase 45 from Arabidopsis with 63.61% of identity |
Eggnog | peroxidase(ENOG4111S7R) |
Kegg | Link to kegg annotations (AT2G18980) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447519.1) |
Pfam | Peroxidase (PF00141.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer