Protein coding transcript 27270

• Transcript: Ll_transcript_433858
• CDS coordinates: 2382-2801 (+)
• Peptide sequence: MVDAGAHTIGFSHCSQFSKRIYNFRSRNKIDPTLNLAYAKQIQQECPKNVDPRMVIDMDPVTNNVFDNNYYKNIQQGKGLLSSDQALFTDRRSRSIVNLFASNSTAFEKSFVIAMTKLGRVGIKTGKQGEIRRNCAMVN*
• ORF Type: complete

Annotations of Ll_transcript_433858

• Blastp: Peroxidase 35 from Arabidopsis with 62.5% of identity
• Blastx: Peroxidase 35 from Arabidopsis with 62.5% of identity
• Eggnog: peroxidase(ENOG4111FDS)
• Kegg: Link to kegg annotations (AT3G49960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447519.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;