| Transcript | Ll_transcript_433850 |
|---|---|
| CDS coordinates | 167-499 (+) |
| Peptide sequence | MAKEVVEGFNFQQRHGKERVRVARVWKDKKSGRYFVVEWRVSVSLLSHCINSYIRDDNSDIVATDTMKNTVYAKAKECSKVLSVENFAIELAKHFTSFYKQKNHGSVLMWM |
| ORF Type | 3prime_partial |
| Blastp | Uricase-2 isozyme 2 from Canavalia with 82.18% of identity |
|---|---|
| Blastx | Uricase-2 isozyme 2 from Canavalia with 82.18% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459627.1) |
| Pfam | Uricase (PF01014.17) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer