Protein coding transcript 2734

• Transcript: Ll_transcript_361480
• CDS coordinates: 2-394 (+)
• Peptide sequence: ENNGDMLCLPNTNSKISSKKHRSCALEFEDIKKHFGVPITQAAKDMNVGLTLLKRRCRELNIMRWPHRKLKSLEFLIENVKEMGLSNEVAMLEQHRKMLEKLPDLELSEETKKLRQTCFKANYKKRWCLV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_361480

• Blastp: Protein RKD4 from Arabidopsis with 62.5% of identity
• Blastx: Protein RKD4 from Arabidopsis with 62.5% of identity
• Eggnog: RWP-RK domain-containing protein(ENOG41120E0)
• Kegg: Link to kegg annotations (AT5G53040)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414766.1)
• Pfam: RWP-RK domain (PF02042.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;