Protein coding transcript 2736

• Transcript: Ll_transcript_361401
• CDS coordinates: 3-548 (+)
• Peptide sequence: SISSYPPPNPVFSGSTSNATKKKDNSGGAPNKELHMFVWSSTASPVSEGNLRHAVNRAASTDFGNIDPSKPIPQETVASKAVHELIENMSPGRRESGDRELEIEEGTKFPTSGSPYTCQKKVDMEEGDANKKQNMPPASVMTRLILIMVWRKLIRNPNTYSSLLGLIWSLISYRWHIEMPTI
• ORF Type: internal

Annotations of Ll_transcript_361401

• Blastp: Auxin efflux carrier component 2 from Arabidopsis with 53.85% of identity
• Blastx: Auxin efflux carrier component 2 from Arabidopsis with 53.85% of identity
• Eggnog: auxin Efflux(ENOG410YAJ0)
• Kegg: Link to kegg annotations (AT5G57090)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442795.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;