Protein coding transcript 2738

• Transcript: Ll_transcript_361454
• CDS coordinates: 105-764 (+)
• Peptide sequence: MAENNVVLLDFWPSSYGMRVKIALAETGVSYECKQEDFQAKSSLLLEMNPVHKMIPVLIHNGKSISESLNIVEYIDEVWNHKHSLLPSDPYKRSQARFWGDFIDKNVYSIGKRVWTVKGEEQELGKKQFIECLKKLEEVLGDNPYFGGENFGYVDVALIPFTSWFYTYETFGNLSIEAECPKLVGWAKRCIEKESVAKSLPHPHKIYEFALEYKQRHGF*
• ORF Type: complete

Annotations of Ll_transcript_361454

• Blastp: Probable glutathione S-transferase parA from Nicotiana with 69.86% of identity
• Blastx: Probable glutathione S-transferase parA from Nicotiana with 69.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107772524)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418295.1)
• Pfam: Glutathione S-transferase, N-terminal domain (PF02798.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;