Protein coding transcript 27383

• Transcript: Ll_transcript_435380
• CDS coordinates: 391-972 (+)
• Peptide sequence: MVLPGIILAFIASSMMKREGYEGIITKSKDVNMNEHEEKESEELNGVELTFEGVTKKIAASSGGCGSGCGGGCGSGCGNAVQSGGCGSGCGGGCGNAVQSGGCGSGCGGGCGNIVKSGGCRGCGTGCGGGCGNIIRSGGCGGGCGSGCGGGCGNIVRSGGCGGCGGGCGGCGGGCGNGNMPKSGARDGELVRE*
• ORF Type: complete

Annotations of Ll_transcript_435380

• Blastp: Glycine-rich domain-containing protein 1 from Arabidopsis with 31.25% of identity
• Blastx: Glycine-rich domain-containing protein 2 from Arabidopsis with 56.25% of identity
• Eggnog: Protein of unknown function (DUF1399)(ENOG4111FEQ)
• Kegg: Link to kegg annotations (AT2G22660)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423774.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;