Protein coding transcript 2747

• Transcript: Ll_transcript_361396
• CDS coordinates: 46-513 (+)
• Peptide sequence: MDTEKLARMQNAARTGGKGTPRRVQKKVHRSSGADDQKLQATLKKMNVQPITQIEEVNMFKSDGNVIHFSAPKVHAAVPSNTFALYGHGEDKELTELVPGILNQLGPDSLASLRKLAESYQSLQKGAEGEKKDEDDDEIPELVEGENFESKNDVE*
• ORF Type: complete

Annotations of Ll_transcript_361396

• Blastp: Nascent polypeptide-associated complex subunit beta from Aspergillus with 77.16% of identity
• Blastx: Nascent polypeptide-associated complex subunit beta from Parastagonospora with 76.88% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (ACLA_097690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001236570.1)
• Pfam: NAC domain (PF01849.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;