Protein coding transcript 27562

• Transcript: Ll_transcript_433819
• CDS coordinates: 88-387 (+)
• Peptide sequence: MQDEHFGIVPLEAMAAYKPVIACNSGGPVESIKNGVTGFLCNPTPQDFSLAMTRFIEDSQFAERMGREARRHVVESFSTKTFGQHLNRYILDIHRGKED*
• ORF Type: complete

Annotations of Ll_transcript_433819

• Blastp: Alpha-1,3/1,6-mannosyltransferase ALG2 from Homo with 53.41% of identity
• Blastx: Alpha-1,3/1,6-mannosyltransferase ALG2 from Homo with 53.41% of identity
• Eggnog: Glycosyl transferase (Group 1(COG0438)
• Kegg: Link to kegg annotations (85365)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456641.1)
• Pfam: Glycosyl transferases group 1 (PF00534.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;