Protein coding transcript 2757

• Transcript: Ll_transcript_361537
• CDS coordinates: 55-816 (+)
• Peptide sequence: MSISTARPLISVYTEKNEASGSTIHLPAIFKAPIRPDVVNFVHQNMAKNRRQPYAVNDQAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWHRHVNVNQKRYALVSAIAASGVPALVQSKGHVVDGIPELPLVVSDKVQELTKTRQAVTFLKSINAWADIEKVYKSRRLRAGKGKMRNRRRIQRRGPLIIYGADQGVVRAFRNIPGVDCIPVAKMNLLKLAPGGHVGRFIIW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_361537

• Blastp: 60S ribosomal protein L4 from Sophophora with 75.69% of identity
• Blastx: 60S ribosomal protein L4 from Sophophora with 75.69% of identity
• Eggnog: One of the primary rRNA binding proteins, this protein initially binds near the 5'-end of the 23S rRNA. It is important during the early stages of 50S assembly. It makes multiple contacts with different domains of the 23S rRNA in the assembled 50S subunit and ribosome (By similarity)(COG0088)
• Kegg: Link to kegg annotations (Dmel_CG5502)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020225369.1)
• Pfam: Ribosomal protein L4/L1 family (PF00573.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;