Transcript | Ll_transcript_434284 |
---|---|
CDS coordinates | 1562-2068 (+) |
Peptide sequence | MMFDRTRRTWKPNVQEKRLFSYALDKHIRIKVTTHALRCIDKAGGIDEYLIKTPYHKMDTELGLFWKAKIEKLYEELGNKEVVFFSPEDEAKFEQGFKDLKLSEKEARKEIRRKMYVGMSKNNVIEEEHKDDDQSKIEEEKSHDAPKLVPVSYVIAADKLKVGSVVSN* |
ORF Type | complete |
Blastp | 50S ribosomal protein L28 from Magnetococcus with 47.92% of identity |
---|---|
Blastx | 50S ribosomal protein L28 from Magnetococcus with 47.92% of identity |
Eggnog | 50s ribosomal protein L28(COG0227) |
Kegg | Link to kegg annotations (Mmc1_0815) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019419625.1) |
Pfam | Ribosomal L28 family (PF00830.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer