Protein coding transcript 27661

• Transcript: Ll_transcript_434289
• CDS coordinates: 121-441 (+)
• Peptide sequence: MAFRGKQMMNKVLKKVGEKNLAPRVKESLEKYIPQSKVIMGRAKRGLFSGRHIQFGNNVSEDGGNKTRRTWKPNVQEKRLFSYALDKHIRIKVTTHALRCIDKAGGI
• ORF Type: 3prime_partial

Annotations of Ll_transcript_434289

• Blastp: 54S ribosomal protein L24, mitochondrial from Saccharomyces with 40% of identity
• Blastx: 54S ribosomal protein L24, mitochondrial from Saccharomyces with 40% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YMR193W)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419625.1)
• Pfam: Ribosomal L28 family (PF00830.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;