Protein coding transcript 27663

• Transcript: Ll_transcript_434291
• CDS coordinates: 1484-1990 (+)
• Peptide sequence: MMFDRTRRTWKPNVQEKRLFSYALDKHIRIKVTTHALRCIDKAGGIDEYLIKTPYHKMDTELGLFWKAKIEKLYEELGNKEVVFFSPEDEAKFEQGFKDLKLSEKEARKEIRRKMYVGMSKNNVIEEEHKDDDQSKIEEEKSHDAPKLVPVSYVIAADKLKVGSVVSN*
• ORF Type: complete

Annotations of Ll_transcript_434291

• Blastp: 50S ribosomal protein L28 from Magnetococcus with 47.92% of identity
• Blastx: 50S ribosomal protein L28 from Magnetococcus with 47.92% of identity
• Eggnog: 50s ribosomal protein L28(COG0227)
• Kegg: Link to kegg annotations (Mmc1_0815)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419625.1)
• Pfam: Ribosomal L28 family (PF00830.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;