Protein coding transcript 2768

• Transcript: Ll_transcript_361385
• CDS coordinates: 153-1655 (+)
• Peptide sequence: MSKLIRSKWNLYTTTLRVYTSSAASPQTDPLFLRISRAGDPNIPITLILNQWVQEGRDVIHSELQFFVKQLRSYRRFNHALQVSEWMSSERNLHLLSGDIAIRLDLIAKVHGQDQAEKYFDSISDASRDFKVYGALLNCYAQHRSVEKAEAVMQKIKENASKQAIDLVVSYNVMLKLYARIGDHEKFDNLKQEMISKSIYDIFTLKSCLNAYVTAKDINGMEKLLMQMEADPVLNVDWLTYSIAANCYIKAGQFYKSDAMLKKSEKLVNGKMRRNAYESLLTMYAVIGQKDDVYRIWNKCKNLSHSRNSSYVCVLSALAKLNDIDGAEKILEEWESGNTCFDIRIPNVMITAYCKNGLIEKAEAYIERLLKGGNELNGSTWDRLAHGYCKCNDMDNAVQTLKKAILVGPPGWKPYLSTLAACIDHVKENGDLDLAMEILTIMERGRFSAATCDKLLSYVRGEIAETNAFDLMKEDYYLNADEVPDGEKQHEMLLKGEVSN*
• ORF Type: complete

Annotations of Ll_transcript_361385

• Blastp: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial from Arabidopsis with 43.35% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g20710, mitochondrial from Arabidopsis with 43.35% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G20710)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464868.1)
• Pfam: PPR repeat (PF01535.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;