Protein coding transcript 27757

• Transcript: Ll_transcript_433712
• CDS coordinates: 572-1042 (+)
• Peptide sequence: MSQWNNTRLNRILVDYLLRMSYYGTAAKLAECTNIQDLVDIDIFQEAKRVIDALQNKDVSPALAWCAENKPRLKKSKSKLEFQLRLQEFIELVRAENNLQAITYARKYLAPWGATHMKELQRVFATIAFKRDTEYATYKVRLHHALGFLCLSYKYF*
• ORF Type: complete

Annotations of Ll_transcript_433712

• Blastp: Macrophage erythroblast attacher from Rattus with 44.93% of identity
• Blastx: Macrophage erythroblast attacher from Rattus with 43.64% of identity
• Eggnog: Macrophage erythroblast attacher(ENOG410XPGU)
• Kegg: Link to kegg annotations (298982)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453489.1)
• Pfam: CTLH/CRA C-terminal to LisH motif domain (PF10607.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;