Protein coding transcript 27758

• Transcript: Ll_transcript_433713
• CDS coordinates: 777-1535 (+)
• Peptide sequence: MSEWNNTRLKRILVDYMLRMSYYETAVKFAECSNIQDLVDIDVFQEAKTVMDALQNKDVSPALAWCAENKSRLKKTKSKLEFQLRLQEFIELVRAENNLRAITYARKHLAPWGATHMKELQRVIATLAFKRDTECATYKVLFEARQWDCLVDEFKQEFCKLYGMTLQPLLNIYLQAGLSALKTPYCYEDDCTKDDPLSQESFRTLALPLPYSKQQHSKLVCYITKELMDTENPPQVLPNGYVYSTKALEDMAK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_433713

• Blastp: Macrophage erythroblast attacher from Danio with 43.55% of identity
• Blastx: Macrophage erythroblast attacher from Danio with 41.2% of identity
• Eggnog: Macrophage erythroblast attacher(ENOG410XPGU)
• Kegg: Link to kegg annotations (321575)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428745.1)
• Pfam: CTLH/CRA C-terminal to LisH motif domain (PF10607.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;