Transcript | Ll_transcript_433695 |
---|---|
CDS coordinates | 3-518 (+) |
Peptide sequence | LAPWGATHMKELQRVFATIAFKRDTEYATYKVLFEAKQWDFLVDQFRQEFCKVYGMTLEPLLNIYLQAGLSALKTPYCYEDDCTKEDPLSQESFRTLAMSLPYSKQHHSKLVCYISKEIMDTENPPQVLPNGYVYSTKALEEMARKNDGRIKCPRTGFVCNYTEVMKAYIS* |
ORF Type | 5prime_partial |
Blastp | Macrophage erythroblast attacher from Danio with 38.55% of identity |
---|---|
Blastx | Macrophage erythroblast attacher from Danio with 38.55% of identity |
Eggnog | Macrophage erythroblast attacher(ENOG410XPGU) |
Kegg | Link to kegg annotations (321575) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003536784.1) |
Pfam | CTLH/CRA C-terminal to LisH motif domain (PF10607.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer