Protein coding transcript 2778

• Transcript: Ll_transcript_502738
• CDS coordinates: 219-629 (+)
• Peptide sequence: MALKEGSLLLLLTFIACFIVSGIATRDLVMKPKQDISARLERNNGDLVNCWSSLLELKSCSNEIVLFFLNGVADIGPSCCIAITVITHNCWPAMLTSLGFTAEEGNILRGYCDAVAASASTPTPTPAASPYSIFIN*
• ORF Type: complete

Annotations of Ll_transcript_502738

• Blastp: Egg cell-secreted protein 1.4 from Arabidopsis with 48.41% of identity
• Blastx: Egg cell-secreted protein 1.4 from Arabidopsis with 50.44% of identity
• Eggnog: mediates the redistribution of the gamete fusogen HAP2 GCS1 to the cell surface after secretion upon sperm arrival(ENOG410Z0ND)
• Kegg: Link to kegg annotations (AT4G39340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430207.1)
• Pfam: Prolamin-like (PF05617.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;