Protein coding transcript 2779

• Transcript: Ll_transcript_502704
• CDS coordinates: 1-1041 (+)
• Peptide sequence: LKIKRIESYYSLKTRSTLNPKNARATLRRCRTSRIAAAETVSAAAATPFLSNLSFVISIMVGLSLGEQHFIQGGIAQDLRCDGRKRLAYRPISVETGVIPQANGSARVRMGATDVIASVKAELGKPSLLQPNKGKVSINIDCSSTAEPAFEGRGGDELSAELSTALQRCLLGGKSGAGAGIDLSSLVVIDGKICWDLYIDGLVVSSDGNLLDALGAAIKAALSNTGIPRVHVAAGASSDEKPDIDVSDEEFLQFDTSSVPVIVTLTKVGKHYIVDATSEEESQMSSAVSISVNRQRSICGITKRGGAGLDPSIILDMISVAQHVSEQLINKLDSEIASAEAGDDES*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_502704

• Blastp: Exosome complex component RRP42 from Homo with 40% of identity
• Blastx: Exosome complex component RRP42 from Homo with 40% of identity
• Eggnog: Exosome complex(COG2123)
• Kegg: Link to kegg annotations (23016)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462378.1)
• Pfam: 3' exoribonuclease family, domain 1 (PF01138.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;