| Transcript | Ll_transcript_433610 |
|---|---|
| CDS coordinates | 560-886 (+) |
| Peptide sequence | MNDSAVNKDATLSSTNFLGQSSGSRRVALSGSREAFAGSESDIRTRTTEFSSGAAYKISSGQKSSPLGSSDPKRVVPSGRNASHVKNYEAAVKGIEGLQLENEERTHH* |
| ORF Type | complete |
| Blastp | Casein kinase 1-like protein 1 from Arabidopsis with 34.95% of identity |
|---|---|
| Blastx | Casein kinase 1-like protein 1 from Arabidopsis with 37.16% of identity |
| Eggnog | Casein Kinase(ENOG410XPGP) |
| Kegg | Link to kegg annotations (AT4G26100) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415527.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer