Protein coding transcript 27885

• Transcript: Ll_transcript_433948
• CDS coordinates: 1-480 (+)
• Peptide sequence: KKLPLNAVTSIIDGLKRLYVERLKPLEVAYQFNDFVSPLLTDSDFDAKPMVMLLGQYSTGKTTFIKHLLKCEYPGAHIGPEPTTDRFVVVMSGPDERSIPGNTVAVDASMPFSGLSTFGGSFLSKFQCSQMPHPVSSLYIKKFLFFSTIDCIMYWCLNN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_433948

• Blastp: EH domain-containing protein 1 from Arabidopsis with 88.28% of identity
• Blastx: EH domain-containing protein 1 from Arabidopsis with 76.51% of identity
• Eggnog: EH-domain containing(ENOG410XYGB)
• Kegg: Link to kegg annotations (AT3G20290)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463519.1)
• Pfam: N-terminal EH-domain containing protein (PF16880.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;