Protein coding transcript 27895

• Transcript: Ll_transcript_433952
• CDS coordinates: 1043-1480 (+)
• Peptide sequence: MDEDFVGPLGLDLFEKEQSNLLADLIDIPKKACDRRINEFVKRARSAKIHAYIISHLKKEMPAIMGKAKAQQRLIDNLDEEFGKVQREFHLSAGDFPSVENFKEVLSRYNIDKFEKLKPKMVQAVDDMLGYEIPELLKKFRNPYN*
• ORF Type: complete

Annotations of Ll_transcript_433952

• Blastp: EH domain-containing protein 2 from Arabidopsis with 81.38% of identity
• Blastx: EH domain-containing protein 2 from Arabidopsis with 82.12% of identity
• Eggnog: EH-domain containing(ENOG410XYGB)
• Kegg: Link to kegg annotations (AT4G05520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418916.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;