Protein coding transcript 27915

• Transcript: Ll_transcript_434407
• CDS coordinates: 567-989 (+)
• Peptide sequence: MIIICLFFLEEQHIVHGDIKPDNLLITRHGTVKIGDFSVSQAFEDDKDDLRRSPGTPVFTAPECILGLTYHGKAADTWAVGVTLYCMILGEYPFLGDTLQDTYDRIVNNPIVLPNDMNPQLKNLMEGLLSKGIWHSIFLS*
• ORF Type: complete

Annotations of Ll_transcript_434407

• Blastp: Serine/threonine-protein kinase GRIK1 from Arabidopsis with 70% of identity
• Blastx: Serine/threonine-protein kinase GRIK1 from Arabidopsis with 55.38% of identity
• Eggnog: Calcium calmodulin-dependent protein kinase kinase(ENOG410YHHF)
• Kegg: Link to kegg annotations (AT3G45240)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453977.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;