Protein coding transcript 27921

• Transcript: Ll_transcript_433355
• CDS coordinates: 369-1076 (+)
• Peptide sequence: MMEWQKKEMTMMNGNEMMYVKVMSDEQLETLRKQIAVYATICEQLIQMHNTLSTHQNLSGVRVGNMYCDPLMNSIGHKLTSRQRWTPTPMHLQVLERVFEQGIGTPSKEKIKEITADLIQHGQISETNVYNWFQNRRARSKRKQQQQNLGSSNAESEVDTEVDSKEKKTKAKEFQSQHRVTSGVFENPQVSYDLQYLNSESNEPDSMFPPEGNLSPSRNFSDVPVFDGMLSNSSM*
• ORF Type: complete

Annotations of Ll_transcript_433355

• Blastp: WUSCHEL-related homeobox 13 from Arabidopsis with 50.66% of identity
• Blastx: WUSCHEL-related homeobox 13 from Arabidopsis with 50.66% of identity
• Eggnog: wuschel-related homeobox(ENOG4111P6E)
• Kegg: Link to kegg annotations (AT4G35550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456714.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;