Transcript | Ll_transcript_433348 |
---|---|
CDS coordinates | 3-953 (+) |
Peptide sequence | IGFRLSFWTGLNLNTLISSNNICIGSGSNLGPLFGQKYPHGRIYDHLVCRHQPLPISNVRRQQQQQHLFLLLFHICSEILNMMEWQKKEMTMMNGNEMMYVKVMSDEQLETLRKQIAVYATICEQLIQMHNTLSTHQNLSGVRVGNMYCDPLMNSIGHKLTSRQRWTPTPMHLQVLERVFEQGIGTPSKEKIKEITADLIQHGQISETNVYNWFQNRRARSKRKQQQQNLGSSNAESEVDTEVDSKEKKTKAKEFQSQHRVTSGVFENPQVSYDLQYLNSESNEPDSMFPPEGNLSPSRNFSDVPVFDGMLSNSSM* |
ORF Type | 5prime_partial |
Blastp | WUSCHEL-related homeobox 13 from Arabidopsis with 51.54% of identity |
---|---|
Blastx | WUSCHEL-related homeobox 13 from Arabidopsis with 50.66% of identity |
Eggnog | wuschel-related homeobox(ENOG4111P6E) |
Kegg | Link to kegg annotations (AT4G35550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456714.1) |
Pfam | Homeobox domain (PF00046.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer