Protein coding transcript 27954

• Transcript: Ll_transcript_435140
• CDS coordinates: 59-532 (+)
• Peptide sequence: MDNLIPNHLYIQEEFQLALFRNKNKRNLFADRIFDLFDVKRNGVIEFGEFVRSLGTFHPNAALDDKIAFAFRLYDLRQTGYIEREELKLMVLALLNESDLVLSDDMIEAIVDKTFSDADTKGQGRIDQDQWKAFVSKHPSLIKNMTLPYLKLVYAFF*
• ORF Type: complete

Annotations of Ll_transcript_435140

• Blastp: Calcineurin B-like protein 4 from Arabidopsis with 73.15% of identity
• Blastx: Calcineurin B-like protein 4 from Arabidopsis with 73.15% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT5G24270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437363.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;