Protein coding transcript 27955

• Transcript: Ll_transcript_435141
• CDS coordinates: 208-597 (+)
• Peptide sequence: MGCYFSTSKEAKTPGYEEPSVLASETPFTVSEVEALYELYKKLSNSVIQDGLIHKIFDLFDVKRNGVIEFGEFVRSLGTFHPNAALDDKIACKITLLHKDFRLMYLAILYAMVIYIGLHHILYLLLSLG*
• ORF Type: complete

Annotations of Ll_transcript_435141

• Blastp: Calcineurin B-like protein 4 from Arabidopsis with 57.52% of identity
• Blastx: Calcineurin B-like protein 7 from Oryza sativa with 70.19% of identity
• Eggnog: Calcium-binding protein(COG5126)
• Kegg: Link to kegg annotations (AT5G24270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437363.1)
• Pfam: EF-hand domain pair (PF13833.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;