Transcript | Ll_transcript_502809 |
---|---|
CDS coordinates | 1457-2122 (+) |
Peptide sequence | MADVCRHHRRWVAEKLGPKARNDELDFTKKILSIDAKHYHAWSHRQWVLQALGGWEDELSYCSELLEADVFNNSAWNQRYFVVTRSPFLGGLEATRESEVLYTVQAIIACPENESSWRYLRGLYKGDTTSWVNDPQVSAVCLKILNSKSNYLFALSTLLDLLCSGFQPNQEFRDAVEALKTSDLDKEDQDIARDICSILEHVDPIRANYWIWRKSLLPQTA* |
ORF Type | complete |
Blastp | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha from Pisum with 77.67% of identity |
---|---|
Blastx | Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha from Pisum with 77.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436568.1) |
Pfam | Protein prenyltransferase alpha subunit repeat (PF01239.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer