Protein coding transcript 2800

• Transcript: Ll_transcript_502809
• CDS coordinates: 1457-2122 (+)
• Peptide sequence: MADVCRHHRRWVAEKLGPKARNDELDFTKKILSIDAKHYHAWSHRQWVLQALGGWEDELSYCSELLEADVFNNSAWNQRYFVVTRSPFLGGLEATRESEVLYTVQAIIACPENESSWRYLRGLYKGDTTSWVNDPQVSAVCLKILNSKSNYLFALSTLLDLLCSGFQPNQEFRDAVEALKTSDLDKEDQDIARDICSILEHVDPIRANYWIWRKSLLPQTA*
• ORF Type: complete

Annotations of Ll_transcript_502809

• Blastp: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha from Pisum with 77.67% of identity
• Blastx: Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha from Pisum with 77.67% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436568.1)
• Pfam: Protein prenyltransferase alpha subunit repeat (PF01239.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;