Transcript | Ll_transcript_434426 |
---|---|
CDS coordinates | 72-497 (+) |
Peptide sequence | MGSSKKLIEVLTDEQSPHKWCVSLGEEVFKRFFSQVNPTVHKVFGDGSLFSPMLFGKFFDPSDAFPLWEFESDILLSHLRSTNQSTVDWCQTDEGYILKAEIPGNKDSFSFSCVNILELFFMNRVRVKKIVTWFCLVWVYK* |
ORF Type | complete |
Blastp | 21.7 kDa class VI heat shock protein from Arabidopsis with 59.38% of identity |
---|---|
Blastx | 21.7 kDa class VI heat shock protein from Arabidopsis with 59.38% of identity |
Eggnog | kDa class VI heat shock(ENOG410YHRU) |
Kegg | Link to kegg annotations (AT5G54660) |
CantataDB | Link to cantataDB annotations (CNT0000798) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457701.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer