Protein coding transcript 2802

• Transcript: Ll_transcript_502777
• CDS coordinates: 2-613 (+)
• Peptide sequence: LTTEVSMEDYLVKGLKVAFDSSFAPQTSKKSGSISSAFKNDCCALNCNVDLLNGAPLVLASTVIAYNGWLAGYQTKFDAQNTKITMNNIALGYSTNDFTFHTNVNDGQQFGASLYQKARSDLETGVQLSWKMGSNDTTFGLACKYQLDGDASVRAKVNNNSQIGLGYQQKLRDGVTLTLSTMIDGKNFNQGGHKLGLALEFSA*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_502777

• Blastp: Voltage-dependent anion-selective channel protein 2 from Meleagris with 56.16% of identity
• Blastx: Voltage-dependent anion-selective channel protein 2 from Meleagris with 56.16% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003552508.1)
• Pfam: Eukaryotic porin (PF01459.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;