Transcript | Ll_transcript_502777 |
---|---|
CDS coordinates | 2-613 (+) |
Peptide sequence | LTTEVSMEDYLVKGLKVAFDSSFAPQTSKKSGSISSAFKNDCCALNCNVDLLNGAPLVLASTVIAYNGWLAGYQTKFDAQNTKITMNNIALGYSTNDFTFHTNVNDGQQFGASLYQKARSDLETGVQLSWKMGSNDTTFGLACKYQLDGDASVRAKVNNNSQIGLGYQQKLRDGVTLTLSTMIDGKNFNQGGHKLGLALEFSA* |
ORF Type | 5prime_partial |
Blastp | Voltage-dependent anion-selective channel protein 2 from Meleagris with 56.16% of identity |
---|---|
Blastx | Voltage-dependent anion-selective channel protein 2 from Meleagris with 56.16% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003552508.1) |
Pfam | Eukaryotic porin (PF01459.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer