Protein coding transcript 2803

• Transcript: Ll_transcript_502793
• CDS coordinates: 390-875 (+)
• Peptide sequence: MAGASSNIPTEIVSHEEMLSIEAVLASASAASSPVTPPSIHSHTSVQAESNNSISVRAKRRLFYSAELDIEDYGKMVMTKKKTRVAETLLHRFRSKRGLFVTDVTKTEWCEKQMEFSLFFEEWKSNNEEEWCNKKQKDLALVYGGRKNNEARKAGIVGYFI*
• ORF Type: complete

Annotations of Ll_transcript_502793

• Blastp: Exonuclease V, chloroplastic from Arabidopsis with 41.6% of identity
• Blastx: Exonuclease V, chloroplastic from Arabidopsis with 47.01% of identity
• Eggnog: Exonuclease(ENOG4111IID)
• Kegg: Link to kegg annotations (AT5G60370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441456.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;