Protein coding transcript 28044

• Transcript: Ll_transcript_433682
• CDS coordinates: 1445-1747 (+)
• Peptide sequence: MQFDAAYARWLEEHNRQINELMAAVNSHAGDIELRTIVDNVMTQFDEIFRLKGIAAKADVFHILSGMWKTPAERCFIWIGDFRSSELLKLLANQLEPLSEQ
• ORF Type: 3prime_partial

Annotations of Ll_transcript_433682

• Blastp: TGACG-sequence-specific DNA-binding protein TGA-2.1 from Nicotiana with 43.26% of identity
• Blastx: Transcription factor TGA2.2 from Oryza sativa with 76.65% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107782457)
• CantataDB: Link to cantataDB annotations (CNT0000777)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429722.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;