Protein coding transcript 2806

• Transcript: Ll_transcript_502818
• CDS coordinates: 3-377 (+)
• Peptide sequence: QIMKDFKQNRIGTNGVISAANELFKEHDHLLLGLNKFLPKGYEIQLPLRNEESTMADFKNKVKTRFEENCHIYESFLDIIKKFEDGKKSTIEALEEIATLLEDHEDLLQELVQFLSNVSGLGST*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_502818

• Blastp: Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 44.7% of identity
• Blastx: Paired amphipathic helix protein Sin3-like 3 from Arabidopsis with 45.92% of identity
• Eggnog: Paired AMPhipathic helix protein(COG5602)
• Kegg: Link to kegg annotations (AT1G24190)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435131.1)
• Pfam: Paired amphipathic helix repeat (PF02671.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;