Protein coding transcript 2809

• Transcript: Ll_transcript_502796
• CDS coordinates: 123-611 (+)
• Peptide sequence: MTRELQLNSEPNPDHFHSNLLSFVQKYGTEVTKAFFPSFSSLPLLNSERSVIQSPRNSISFEMNQNLKTVSGKNGVDDSALKGSLCELSKEVTKELDLVPAMKELGLVSEVPQAHHKYIDECEATLNDQINVVYNISYIYHALYAYFDRDTVALKGFANEEKR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_502796

• Blastp: Ferritin-4, chloroplastic from Arabidopsis with 50.47% of identity
• Blastx: Ferritin-4, chloroplastic from Arabidopsis with 50.47% of identity
• Eggnog: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis (By similarity)(COG1528)
• Kegg: Link to kegg annotations (AT2G40300)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017430369.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;