Transcript | Ll_transcript_434585 |
---|---|
CDS coordinates | 258-653 (+) |
Peptide sequence | MNPMSWATPDDVLLSTSLATYLDKKIIVLLRDGRKLLGLLRSFDQFANVVLEGACERVIVGDLYCDVPLGLYVIRGENVVLIGELDLGKEELPPHMACVSEAEIRKAQKADRESSDLKGTMRKRMEFLDFD* |
ORF Type | complete |
Blastp | Sm-like protein LSM1B from Arabidopsis with 78.91% of identity |
---|---|
Blastx | Sm-like protein LSM1B from Arabidopsis with 78.91% of identity |
Eggnog | LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae)(ENOG411224Q) |
Kegg | Link to kegg annotations (AT3G14080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019415981.1) |
Pfam | LSM domain (PF01423.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer