Protein coding transcript 28135

• Transcript: Ll_transcript_434491
• CDS coordinates: 696-1577 (+)
• Peptide sequence: MGKSTSTSNSREWTQIYAIYGMDQWQTLIFLLTQAILFSVFSILYLLYFTVICIFFERFLASGTARFAAGFIAAVIVLSAVCLYFAAANFFYSAVPLHYDMANRIVSAVSDWSSVKLALDLGCCGRGILLNAVATQLKKEGSSGRVVGLDRSKQTTLSTLRSAVTEGVGEYVTCREGDARRLPFPDNYFDVVVSGVFVHTVGVGRRSAAEAAAERMRAVGEVVRVMKPGGVGVVWDLLHVPEYVVRLKELKMEDISLSERVTAFMVNSHIVSFRKPSHHLHGPPEVRLDWRLC*
• ORF Type: complete

Annotations of Ll_transcript_434491

• Blastp: Demethylmenaquinone methyltransferase from Lactobacillus with 30.57% of identity
• Blastx: Demethylmenaquinone methyltransferase from Lactobacillus with 30.36% of identity
• Eggnog: Methyltransferase required for the conversion of demethylmenaquinone (DMKH2) to menaquinone (MKH2)(COG2226)
• Kegg: Link to kegg annotations (LJ_0053)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454586.1)
• Pfam: ubiE/COQ5 methyltransferase family (PF01209.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;