Protein coding transcript 2819

• Transcript: Ll_transcript_502788
• CDS coordinates: 139-813 (+)
• Peptide sequence: MFSFNHFDFLDQHPSNPDTSSSSPISEVGSAYHAAAISSDEVLLASNHPKKRSGRKKFKETRHPVYRGIRRRNSDKWVCEVREPNKKSRIWLGTFPTAEMAARAHDVAAIALRGKNACLNFADSAWRLPVPASAEASDIQKAAAEAAEAFRPRKELTTEEGNLVNESEVTAVEAQEEESSSVPEWLRDMVFMSPTHYNYNIGSEYYNHDVDFDDVEISLWNYSI*
• ORF Type: complete

Annotations of Ll_transcript_502788

• Blastp: Dehydration-responsive element-binding protein 1A from Arabidopsis with 52.73% of identity
• Blastx: Dehydration-responsive element-binding protein 1A from Arabidopsis with 52.66% of identity
• Eggnog: dehydration-responsive element-binding protein(ENOG410YK37)
• Kegg: Link to kegg annotations (AT4G25480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439183.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;