Transcript | Ll_transcript_502678 |
---|---|
CDS coordinates | 59-661 (+) |
Peptide sequence | MDFRGIGFDPRMLDFLVDHIDFSDETDTKSHHAPSRAYVRDSKAMASTHADILDYPDAYKFVVDMPGLKSDQIKVTMEDDTLVLCGERRRDKEKDHKEGVKYLRMERRQGKFLKKFELPENANPDEICACYLDGVLTVTVRKKPPPEPKKPKTIQVQVNSPEPQSQSHAGGAIQDGQNQKSQSQENQDNAATQDSHDKRA* |
ORF Type | complete |
Blastp | 17.9 kDa class II heat shock protein from Soja with 59.01% of identity |
---|---|
Blastx | 17.9 kDa class II heat shock protein from Soja with 59.01% of identity |
Eggnog | response to heat(COG0071) |
Kegg | Link to kegg annotations (100813195) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416317.1) |
Pfam | Hsp20/alpha crystallin family (PF00011.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer