Protein coding transcript 2827

• Transcript: Ll_transcript_502813
• CDS coordinates: 760-1287 (+)
• Peptide sequence: MSMKELIDCKHPTAWIEFEKGLIDEVELARKFFKDGRDFDLEGLKTCMSNGYSYIEGIQGLLLALKQNNYEIHAFTNYPIWYQLIEDKLKLSKYLSWTFCSCINGKRKPNTEFYMEVLSHLEVDPVNCIFVDDRQKNVEAAIEVGIRGVHFKNVNLLREELSLIGIDITTDEEDQ*
• ORF Type: complete

Annotations of Ll_transcript_502813

• Blastp: Flavin mononucleotide hydrolase 1, chloroplatic from Arabidopsis with 65.29% of identity
• Blastx: Flavin mononucleotide hydrolase 1, chloroplatic from Arabidopsis with 65.12% of identity
• Eggnog: Hydrolase(COG1011)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459505.1)
• Pfam: Haloacid dehalogenase-like hydrolase (PF13419.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;