Transcript | Ll_transcript_502813 |
---|---|
CDS coordinates | 760-1287 (+) |
Peptide sequence | MSMKELIDCKHPTAWIEFEKGLIDEVELARKFFKDGRDFDLEGLKTCMSNGYSYIEGIQGLLLALKQNNYEIHAFTNYPIWYQLIEDKLKLSKYLSWTFCSCINGKRKPNTEFYMEVLSHLEVDPVNCIFVDDRQKNVEAAIEVGIRGVHFKNVNLLREELSLIGIDITTDEEDQ* |
ORF Type | complete |
Blastp | Flavin mononucleotide hydrolase 1, chloroplatic from Arabidopsis with 65.29% of identity |
---|---|
Blastx | Flavin mononucleotide hydrolase 1, chloroplatic from Arabidopsis with 65.12% of identity |
Eggnog | Hydrolase(COG1011) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459505.1) |
Pfam | Haloacid dehalogenase-like hydrolase (PF13419.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer