Protein coding transcript 28272

• Transcript: Ll_transcript_433514
• CDS coordinates: 467-1015 (+)
• Peptide sequence: MVLIEQVLLFYLIIFVFCAELRNDHKEITEKIDQNIQILHSARLENKSSPFKNSGNDDGSDTQTSSTVDAVASTLSQNVLLRHSPNSMDVDVLVSRPFAMVDEISDASPAAADGLQLGDQILKFGNVEAGDNLLQRLSSEAQSNQGHSVPVAIMRQGTVINLTVTPRTWQGRGLLGCHFRIL*
• ORF Type: complete

Annotations of Ll_transcript_433514

• Blastp: 26S proteasome non-ATPase regulatory subunit 9 from Bos with 31.52% of identity
• Blastx: 26S proteasome non-ATPase regulatory subunit 9 from Bos with 31.52% of identity
• Eggnog: Serine protease(COG0265)
• Kegg: Link to kegg annotations (513315)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432553.1)
• Pfam: PDZ domain (PF13180.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;