Transcript | Ll_transcript_433516 |
---|---|
CDS coordinates | 113-805 (+) |
Peptide sequence | MVATNVKAETISLMEKRSFIESEMNAIISRLTQPGAPGISGNLLDFEGFPRTDIDIPAIRAERRRLTELRNDHKEITEKIDQNIQILHSARLENKSSPFKNSGNDDGSDTQTSSTVDAVASTLSQNVLLRHSPNSMDVDVLVSRPFAMVDEISDASPAAADGLQLGDQILKFGNVEAGDNLLQRLSSEAQSNQGHSVPVAIMRQGTVINLTVTPRTWQGRGLLGCHFRIL* |
ORF Type | complete |
Blastp | 26S proteasome non-ATPase regulatory subunit 9 from Bos with 31.02% of identity |
---|---|
Blastx | 26S proteasome non-ATPase regulatory subunit 9 from Bos with 31.02% of identity |
Eggnog | Serine protease(COG0265) |
Kegg | Link to kegg annotations (513315) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019432553.1) |
Pfam | PDZ domain (PF13180.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer