Protein coding transcript 28292

• Transcript: Ll_transcript_434117
• CDS coordinates: 39-650 (+)
• Peptide sequence: MEGLKGFLKKGLGEMAFNAGGGAINWFPGHMAAATRAIRHRLKVADLVIEVRDSRIPLSSANADLQPLLSGKRRVVALNKKDLANPNIMHKWVRYFETCKQDCIPINAHSKSSVNKLLELVEFKLKELISREPTLLVMVVGVPNVGKSALINSIHQIAQSRFPVQEKMKRATVGPLPGVTQDIAGFKVCWFYLYGISVNYSLW*
• ORF Type: complete

Annotations of Ll_transcript_434117

• Blastp: Short integuments 2, mitochondrial from Arabidopsis with 77.54% of identity
• Blastx: Short integuments 2, mitochondrial from Arabidopsis with 78.86% of identity
• Eggnog: Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity (By similarity)(COG1161)
• Kegg: Link to kegg annotations (AT2G41670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444057.1)
• Pfam: 50S ribosome-binding GTPase (PF01926.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;