Protein coding transcript 2830

• Transcript: Ll_transcript_502754
• CDS coordinates: 3-644 (+)
• Peptide sequence: KTHRDRELKKKRYLEEGCVVGVQEILRRSGSTTNMSSSLCVTPLQFQPRTPSQSSSSFFHSHVRGTTSATLSLRPLSPLPSTTLSHKLRFQPKLNHSSTTIRCSFALTPELKSTLDKVVSSNKVVLFMKGTKDFPQCGFSNTVVQILKSQNVPFETINILENELLRQGLKEYSSWPTFPQLYIEGEFFGGCDITVEAYQNGQLQELLEKAMCN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_502754

• Blastp: Monothiol glutaredoxin-S14, chloroplastic from Arabidopsis with 67.35% of identity
• Blastx: Monothiol glutaredoxin-S14, chloroplastic from Arabidopsis with 71.54% of identity
• Eggnog: Glutaredoxin(COG0278)
• Kegg: Link to kegg annotations (AT3G54900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429421.1)
• Pfam: Glutaredoxin (PF00462.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;